PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_21220V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 608aa    MW: 66746.5 Da    PI: 7.5819
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_21220V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-16164209147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg W + Ed++l ++v q+G+ +W++Ia++++ gR++k+c++rw++ 
  Pp3c7_21220V3.3.p 164 RGHWRPAEDDKLRELVSQFGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 209
                        899*****************************.***********996 PP

2Myb_DNA-binding53.65.1e-17217259246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++++eE+e+l+ a+k++G++ W++Iar ++ gRt++ +k++w+ 
  Pp3c7_21220V3.3.p 217 HPFSEEEEERLLIAHKRYGNK-WALIARLFP-GRTDNAVKNHWHV 259
                        589******************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.204159210IPR017930Myb domain
SMARTSM007176.5E-14163212IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-28163257IPR009057Homeodomain-like
PfamPF002493.8E-16164209IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-26165217IPR009057Homeodomain-like
CDDcd001671.24E-12167208No hitNo description
PROSITE profilePS5129425.52211265IPR017930Myb domain
SMARTSM007171.5E-13215263IPR001005SANT/Myb domain
PfamPF002492.8E-14217259IPR001005SANT/Myb domain
CDDcd001671.91E-11218258No hitNo description
Gene3DG3DSA:1.10.10.605.5E-20218263IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MAIEVRGSWA ADATKIMGHH FAEEAERMRS MHKSQELETL HNGSVHLGKE YCGGGRTSFF  60
QITGFSAPKT VTTDCEKTSN FGSDSGTPVG YSVPFHMLSM SANERACCVQ SVESCRKFNS  120
DFKISSDDDT EHGSLEDDMK ELNEDMEIPL GRDGEGMQSK QCPRGHWRPA EDDKLRELVS  180
QFGPQNWNLI AEKLQGRSGK SCRLRWFNQL DPRINRHPFS EEEEERLLIA HKRYGNKWAL  240
IARLFPGRTD NAVKNHWHVV TARQSRERTR TYGRIKGPVH RRGKGNRINT SALGNYHHDS  300
KGALTAWIES KYATVEQSAE GLARSPCTGR GSPPLPTGFS IPQISGGAFH RPTNMSTSPL  360
SDVTIESPKF SNSENAQIIT APVLQKPMGD PRSVCLPNST VSDKQQVLQS NSIDGQISSG  420
LQTSAIVAHD EKSGVISMNH QAPDMSCVGL KSNFQGSLHP GAVRSSWNQS LPHCFGHSNK  480
LVEECRSSTG ACTERSEILQ EQHSSLQFKC STAYNTGRYQ HENLCGPAFS QQDTANEVAN  540
FSTLAFSGLV KHRQERLCKD SGSALKLGLS WVTSDSTLDL SVAKMSASQP EQSAPVAFID  600
FLGVGAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-311642644104C-Myb DNA-Binding Domain
1msf_C9e-311642644104C-Myb DNA-Binding Domain
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S2_283V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.19e-62myb domain protein 105